Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d012027_circ_g.2 |
| ID in PlantcircBase | zma_circ_009783 |
| Alias | zma_circ_0002896 |
| Organism | Zea mays |
| Position | chr8: 166753277-166753648 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d012027 |
| Parent gene annotation |
Dynamin-related protein 3A |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d012027_T006:2 Zm00001d012027_T014:2 Zm00001d012027_T011:2 Zm00001d012027_T010:2 Zm00001d012027_T001:2 Zm00001d012027_T008:2 Zm00001d012027_T013:2 Zm00001d012027_T003:2 Zm00001d012027_T002:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.215150538 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
166753376-166753417(+) 166753400-166753590(-) 166753293-166753585(-) |
| Potential amino acid sequence |
MPAPNLDHSFSTIQLREPPVVLKPSEHQSEQEALEIAITKLLLKSYYNIVRKNVEDFIPKAIMH FLVVEAHLSGIKYLLPMRIEHMLLQEITQQTNLMLCLPLIWIIHSPLYS*(+) MIQIRGRHSIRFVCCVISCRSMCSILIGSKYLIPERCASTTRKCIIAFGMKSSTFFLTIL*(-) MCFHYQEMHNCFWYEVLHIFPDNIVI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |