Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d012027_circ_g.2 |
ID in PlantcircBase | zma_circ_009783 |
Alias | zma_circ_0002896 |
Organism | Zea mays |
Position | chr8: 166753277-166753648 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d012027 |
Parent gene annotation |
Dynamin-related protein 3A |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d012027_T006:2 Zm00001d012027_T014:2 Zm00001d012027_T011:2 Zm00001d012027_T010:2 Zm00001d012027_T001:2 Zm00001d012027_T008:2 Zm00001d012027_T013:2 Zm00001d012027_T003:2 Zm00001d012027_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.215150538 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
166753376-166753417(+) 166753400-166753590(-) 166753293-166753585(-) |
Potential amino acid sequence |
MPAPNLDHSFSTIQLREPPVVLKPSEHQSEQEALEIAITKLLLKSYYNIVRKNVEDFIPKAIMH FLVVEAHLSGIKYLLPMRIEHMLLQEITQQTNLMLCLPLIWIIHSPLYS*(+) MIQIRGRHSIRFVCCVISCRSMCSILIGSKYLIPERCASTTRKCIIAFGMKSSTFFLTIL*(-) MCFHYQEMHNCFWYEVLHIFPDNIVI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |