Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d039062_circ_g.1 |
ID in PlantcircBase | zma_circ_009182 |
Alias | zma_circ_0002430 |
Organism | Zea mays |
Position | chr6: 169459070-169460664 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d039062 |
Parent gene annotation |
Putative timeless C-term domain and Homeodomain protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d039062_T008:5 Zm00001d039062_T011:5 Zm00001d039062_T018:5 Zm00001d039062_T001:5 Zm00001d039062_T017:5 Zm00001d039062_T014:5 Zm00001d039062_T010:5 Zm00001d039062_T002:5 Zm00001d039062_T020:5 Zm00001d039062_T006:5 Zm00001d039062_T003:5 Zm00001d039062_T015:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.141058751 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
169460515-169460646(-) |
Potential amino acid sequence |
MFQENVMDIILVLTQHIDEPSGYLKEENLLLMEIYHYLFLGRDPGLIARASNKGLKDRVNGDIV SSVDSLRLMMEEEERKKRMFRQLNSEHSSLSGTFTCFSVDGSKSLCKGNPSSASANSLLKIRNV QRGPQKRIAWDNELLYVPKEGITEMLRSFMDQFLSGAYNILMQSVCGDIMDEHHSIEKSDITTF FKVARFVLAFQHEKASNDQKSAKGIQPSGVSPSNEPDDNLPFHGDICGPVAATLNEDMFNIVIS RWRETYEALKETNDYKTLSAAGSLMKNMNFILRR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |