Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d039062_circ_g.1 |
| ID in PlantcircBase | zma_circ_009182 |
| Alias | zma_circ_0002430 |
| Organism | Zea mays |
| Position | chr6: 169459070-169460664 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d039062 |
| Parent gene annotation |
Putative timeless C-term domain and Homeodomain protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d039062_T008:5 Zm00001d039062_T011:5 Zm00001d039062_T018:5 Zm00001d039062_T001:5 Zm00001d039062_T017:5 Zm00001d039062_T014:5 Zm00001d039062_T010:5 Zm00001d039062_T002:5 Zm00001d039062_T020:5 Zm00001d039062_T006:5 Zm00001d039062_T003:5 Zm00001d039062_T015:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.141058751 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
169460515-169460646(-) |
| Potential amino acid sequence |
MFQENVMDIILVLTQHIDEPSGYLKEENLLLMEIYHYLFLGRDPGLIARASNKGLKDRVNGDIV SSVDSLRLMMEEEERKKRMFRQLNSEHSSLSGTFTCFSVDGSKSLCKGNPSSASANSLLKIRNV QRGPQKRIAWDNELLYVPKEGITEMLRSFMDQFLSGAYNILMQSVCGDIMDEHHSIEKSDITTF FKVARFVLAFQHEKASNDQKSAKGIQPSGVSPSNEPDDNLPFHGDICGPVAATLNEDMFNIVIS RWRETYEALKETNDYKTLSAAGSLMKNMNFILRR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |