Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0521500_circ_g.4 |
| ID in PlantcircBase | osa_circ_039894 |
| Alias | Os_ciR11894 |
| Organism | Oryza sativa |
| Position | chr9: 20373850-20373971 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0521500 |
| Parent gene annotation |
Similar to Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite -translocating ATPase) (Arsenical resistance ATPase) (Arsenite-t ransporting ATPase) (ARSA) (ASNA-I). (Os09t0521500-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0521500_circ_g.1 Os09g0521500_circ_g.2 Os09g0521500_circ_g.3 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0521500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.403686885 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20373928-20373904(-) |
| Potential amino acid sequence |
MEGFLSELTNAIPGVDEAMSFAEMLKKLIQRSKMMTSLMKEWKDSFQN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |