Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0279000_circ_g.5 |
ID in PlantcircBase | osa_circ_011116 |
Alias | Os12circ04243/Os_ciR1247 |
Organism | Oryza sativa |
Position | chr12: 10464191-10464889 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os12g0279000 |
Parent gene annotation |
Helicase, C-terminal domain containing protein. (Os12t0279000-01 ) |
Parent gene strand | + |
Alternative splicing | Os12g0279000_circ_g.2 Os12g0279000_circ_g.3 Os12g0279000_circ_g.4 Os12g0279000_circ_g.6 |
Support reads | 4/14/4 |
Tissues | panicle/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0279000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010382 |
PMCS | 0.602416054 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10464851-10464191(+) 10464275-10464191(+) |
Potential amino acid sequence |
MSSRPENGFFVDWDRRPEDSDYTVDVLTRCSVSKDKSGKKTMKIIPLKDRGEPVVISLPLSQID GLSSIRMHIPKDLLPVEARENTLRKVDEVISRFAKDGIPLLDPEEDMKVQSSSFRKASRRIEAL ESLFEKHDVHNSPHIKQKLKVLHAKQELSTKIKAIKRTMRSSTALAFKDELKARKRVLRRLG*( +) MKIIPLKDRGEPVVISLPLSQIDGLSSIRMHIPKDLLPVEARENTLRKVDEVISRFAKDGIPLL DPEEDMKVQSSSFRKASRRIEALESLFEKHDVHNSPHIKQKLKVLHAKQELSTKIKAIKRTMRS STALAFKDELKARKRVLRRLG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |