Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0279000_circ_g.5 |
| ID in PlantcircBase | osa_circ_011116 |
| Alias | Os12circ04243/Os_ciR1247 |
| Organism | Oryza sativa |
| Position | chr12: 10464191-10464889 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os12g0279000 |
| Parent gene annotation |
Helicase, C-terminal domain containing protein. (Os12t0279000-01 ) |
| Parent gene strand | + |
| Alternative splicing | Os12g0279000_circ_g.2 Os12g0279000_circ_g.3 Os12g0279000_circ_g.4 Os12g0279000_circ_g.6 |
| Support reads | 4/14/4 |
| Tissues | panicle/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0279000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010382 |
| PMCS | 0.602416054 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10464851-10464191(+) 10464275-10464191(+) |
| Potential amino acid sequence |
MSSRPENGFFVDWDRRPEDSDYTVDVLTRCSVSKDKSGKKTMKIIPLKDRGEPVVISLPLSQID GLSSIRMHIPKDLLPVEARENTLRKVDEVISRFAKDGIPLLDPEEDMKVQSSSFRKASRRIEAL ESLFEKHDVHNSPHIKQKLKVLHAKQELSTKIKAIKRTMRSSTALAFKDELKARKRVLRRLG*( +) MKIIPLKDRGEPVVISLPLSQIDGLSSIRMHIPKDLLPVEARENTLRKVDEVISRFAKDGIPLL DPEEDMKVQSSSFRKASRRIEALESLFEKHDVHNSPHIKQKLKVLHAKQELSTKIKAIKRTMRS STALAFKDELKARKRVLRRLG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |