Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d024661_circ_g.2 |
ID in PlantcircBase | zma_circ_010239 |
Alias | zma_circ_0000185, GRMZM2G063363_C1 |
Organism | Zea mays |
Position | chr10: 82544640-82545189 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d024661 |
Parent gene annotation |
Structural molecule |
Parent gene strand | - |
Alternative splicing | Zm00001d024661_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d024661_T001:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.230187271 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
82544737-82545131(+) 82545145-82544668(+) 82544902-82544899(-) |
Potential amino acid sequence |
MLNKLENCCYDTFPWSKYAAGRPHEATLWCCRLELESHMRLADVLDPDSAPDLLTGFINSGTYS TGPLTFRLTILNLTLHLSKGFSLFSGCSTNLKTVAMILSPGASTPPGGLMKQLFGAVVWNLKAT *(+) MFLILTALRTCLPGSSIQGHTPPAL*(+) MRPPGGVLAPGESIIATVFKFVEHPENNEKPLDKCKVKFKIVSLKVKGPVEYVPELMNPVSKSG ALSGSRTSASLMWLSSSKRQHQRVAS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |