Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d024661_circ_g.2 |
| ID in PlantcircBase | zma_circ_010239 |
| Alias | zma_circ_0000185, GRMZM2G063363_C1 |
| Organism | Zea mays |
| Position | chr10: 82544640-82545189 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d024661 |
| Parent gene annotation |
Structural molecule |
| Parent gene strand | - |
| Alternative splicing | Zm00001d024661_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d024661_T001:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.230187271 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
82544737-82545131(+) 82545145-82544668(+) 82544902-82544899(-) |
| Potential amino acid sequence |
MLNKLENCCYDTFPWSKYAAGRPHEATLWCCRLELESHMRLADVLDPDSAPDLLTGFINSGTYS TGPLTFRLTILNLTLHLSKGFSLFSGCSTNLKTVAMILSPGASTPPGGLMKQLFGAVVWNLKAT *(+) MFLILTALRTCLPGSSIQGHTPPAL*(+) MRPPGGVLAPGESIIATVFKFVEHPENNEKPLDKCKVKFKIVSLKVKGPVEYVPELMNPVSKSG ALSGSRTSASLMWLSSSKRQHQRVAS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |