Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G032600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000435 |
| Alias | Chr05:2939047|2939270 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 2939047-2939270 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G032600 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.005G032600_circ_g.2 |
| Support reads | 9/446 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.005G032600.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000242* |
| PMCS | 1.100446801 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2939216-2939106(+) |
| Potential amino acid sequence |
MGEASEASQSCFPWGKIKGRNYLYWNGIRPELVISEPELVKEVLKNSENTFPKKKPSIFFSKLL GNGLVLLEGEKWVKHRKLANHVFHGERLKGGIIFIGTVFDLNWLFQSLN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |