Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G141500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000069 |
| Alias | Chr01:19134252|19137371 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 19134252-19137371 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G141500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/9 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.001G141500.3:6 Gorai.001G141500.5:6 Gorai.001G141500.2:7 Gorai.001G141500.6:5 Gorai.001G141500.4:6 Gorai.001G141500.1:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.106873146 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19134257-19137292(-) 19137116-19137341(-) |
| Potential amino acid sequence |
MRCYCCNIRVSFRCYKDEITSSWVAKAW*(-) MYRGLAPTVLALLPNWAVYFTMYEQLKDCLCSNDGKHQLSVGANMLAASGAGAATTCFTNPLWV VKTRLQTQGMRAGVVPYRGTFSALRRIAHEEGIRGLYSGLVPALAGISHVAIQFPTYEKIKCYL ANQDNTPMDKLGARDVAVASSVSKIFASTLTYPHEVLLLQHSCVL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |