Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc06g072050.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_002060 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr6: 44406919-44407380 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc06g072050.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc06g072050.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.192648503 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
44406960-44406959(+) 44407367-44406981(+) 44407344-44407362(-) |
| Potential amino acid sequence |
MTRINKSFEVKIPRGLLSTVMIAELIRHSSIFLAVARTVSFGSTVTIFEFSEMMVDSEGLNILS RSASINVLELAFQQEWIQGEDLVL*(+) MYWNLPFNKSGFRGKILCYDSHQQVL*(+) MFRPSLSTIISENSKIVTVEPNETVLATAKKMLECRISSAIITVDNKPRGILTSKDLLMRVIAQ DLPPESTLVERQVPIHL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016 |