Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0213800_circ_g.1 |
| ID in PlantcircBase | osa_circ_018515 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 5961605-5963077 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0213800 |
| Parent gene annotation |
Mitochondrial substrate carrier family protein. (Os03t0213800-01 ) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0213800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.139687967 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5963038-5963043(-) |
| Potential amino acid sequence |
MKQRMQVQGTKKSWALTATKGNISQTPGAPMYNYYNGMFHAGCSIWRDHGLKGLYAGYWSTLAR DVPFAGLMVTFYEAMKELTEYGKRKYLPESNLHASSSFEGLLLGGLAGGFSAYLTTPLDVIKTR LQVQGSTTRRYTWVFYLCAM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |