Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0213800_circ_g.1 |
ID in PlantcircBase | osa_circ_018515 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 5961605-5963077 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0213800 |
Parent gene annotation |
Mitochondrial substrate carrier family protein. (Os03t0213800-01 ) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0213800-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.139687967 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5963038-5963043(-) |
Potential amino acid sequence |
MKQRMQVQGTKKSWALTATKGNISQTPGAPMYNYYNGMFHAGCSIWRDHGLKGLYAGYWSTLAR DVPFAGLMVTFYEAMKELTEYGKRKYLPESNLHASSSFEGLLLGGLAGGFSAYLTTPLDVIKTR LQVQGSTTRRYTWVFYLCAM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |