Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0657200_circ_g.12 |
ID in PlantcircBase | osa_circ_035089 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 27664024-27664378 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0657200 |
Parent gene annotation |
WD40/YVTN repeat-like domain containing protein. (Os07t0657200-0 1);WD40/YVTN repeat-like domain containing protein. (Os07t065720 0-02);Similar to Sec31p. (Os07t0657200-03);Similar to Sec31p. (O s07t0657200-04) |
Parent gene strand | + |
Alternative splicing | Os07g0657200_circ_g.13 Os07g0657200_circ_g.14 Os07g0657200_circ_g.15 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0657200-01:1 Os07t0657200-04:1 Os07t0657200-02:1 Os07t0657200-03:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017425 |
PMCS | 0.301588146 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27664184-27664028(+) 27664094-27664225(-) |
Potential amino acid sequence |
MFPGPVANNPTSRFMPSNNPGFVQRPGLSPVQPSSPTQAQGQPQPVVAPPAPPATVQTADTSKV SGC*(+) MVCGGRYTLIWSRLSRSIWWISTQTPSMCQLSAQLREVQEVQQQAAVVLVPVLDLRAVQDSNLA FEQNLDCLMA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |