Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0977600_circ_g.4 |
| ID in PlantcircBase | osa_circ_006074 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 43211686-43212836 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0977600 |
| Parent gene annotation |
Hypothetical conserved gene. (Os01t0977600-01);Armadillo-type fo ld domain containing protein. (Os01t0977600-02);Hypothetical con served gene. (Os01t0977600-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0977600-01:2 Os01t0977600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.120085216 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
43212744-43211720(+) 43212807-43212815(-) |
| Potential amino acid sequence |
MPSSLCNLKSRVKLRKPPRTHQSLKMRSKTLPSGAYLLVHPLV*(+) MGPWWFSQFDPALEVAQAARHSFEAAFPQSDKRLDALMLCVKETFLHLNENLKLTTQALSDKAT PMDELEDMHQREGSCSAS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |