Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0119100_circ_g.1 |
ID in PlantcircBase | osa_circ_000150 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 1092019-1092264 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder |
Parent gene | Os01g0119100 |
Parent gene annotation |
Similar to Glycosyltransferase. (Os01t0119100-00) |
Parent gene strand | - |
Alternative splicing | Os01g0119100_circ_g.2 |
Support reads | 54 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0119100-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.105715515 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1092188-1092246(-) |
Potential amino acid sequence |
MAAPPLWFHPTLLLSLFSRFLLLKRQRILLLSKFQLFQRPKFLLFSRFQHFQWLRQFLRMRS*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |