Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G60870_circ_g.2 |
| ID in PlantcircBase | ath_circ_045075 |
| Alias | Ath_circ_FC4873 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 24486298-24486426 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT5G60870 |
| Parent gene annotation |
Regulator of chromosome condensation (RCC1) family protein |
| Parent gene strand | - |
| Alternative splicing | AT5G60870_circ_g.1 AT5G60870_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G60870.3:1 AT5G60870.2:1 AT5G60870.1:1 AT5G60870.4:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.23883924 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24486374-24486300(-) |
| Potential amino acid sequence |
MPVPSLEGVRITQIACGGYHSLALTANSNYELGRGDNLGGWEPMPVPSLEGVRITQIACGGYHS LALTANSNYELGRGDNLGGWEPMPVPSLEGVRITQIACGGYHSLALTANSNYELGRGDNLGGWE PMPVPSLEGVRITQIACGGYHSLALT(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |