Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA019216_circ_g.4 |
ID in PlantcircBase | osi_circ_005981 |
Alias | 5:3562038|3562537 |
Organism | Oryza sativa ssp. indica |
Position | chr5: 3562038-3562537 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA019216 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA019216_circ_g.2 BGIOSGA019216_circ_g.3 BGIOSGA019216_circ_g.5 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA019216-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_026688* osa_circ_026687 |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3562119-3562328(-) 3562233-3562056(+) 3562445-3562126(+) |
Potential amino acid sequence |
MLPSFSNLTSWSQKDLVTCITSELRFSLQGYDGCHFPWVTYPKIPSVHMMSVYQNLPHHCPC*( -) MESGETTQSISLVDMRKKPEERGLDKEEEDYFNKGSDEEDSDKQTSCAQKESLDKLPKGSDIRH IPARKISIHL*(+) MRKILINRHHVHRRNLWISYPREVTSVISLQGKSQFTCDTCYQILLGPTCEVRKTREHSGL*(+ ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |