Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0334100_circ_g.1 |
| ID in PlantcircBase | osa_circ_019666 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 12351331-12352366 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0334100 |
| Parent gene annotation |
PRC-barrel-like domain containing protein. (Os03t0334100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0334100-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.150745069 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12352124-12351992(+) 12351345-12352171(-) 12351406-12352353(-) |
| Potential amino acid sequence |
MESLELDSFGISIVPSSLVSTYCLFVEDVLDIVSDTIVVHEDAISRVQRLTQWIVALVEVRPSL LSGEAEKFLFEDIYQVGDVVLVEDETVVENEFKLVGLHSLVGYSVVTSRRRNVGKVSLCGL*(+ ) MQQSTVLTVEPERLHLHAPLLYQKLYQAHLQQTSNMCLPD*(-) MSSKRNFSASPESKLGLTSTNATIHCVNR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |