Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0334100_circ_g.1 |
ID in PlantcircBase | osa_circ_019666 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 12351331-12352366 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0334100 |
Parent gene annotation |
PRC-barrel-like domain containing protein. (Os03t0334100-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0334100-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.150745069 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12352124-12351992(+) 12351345-12352171(-) 12351406-12352353(-) |
Potential amino acid sequence |
MESLELDSFGISIVPSSLVSTYCLFVEDVLDIVSDTIVVHEDAISRVQRLTQWIVALVEVRPSL LSGEAEKFLFEDIYQVGDVVLVEDETVVENEFKLVGLHSLVGYSVVTSRRRNVGKVSLCGL*(+ ) MQQSTVLTVEPERLHLHAPLLYQKLYQAHLQQTSNMCLPD*(-) MSSKRNFSASPESKLGLTSTNATIHCVNR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |