Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0688300_circ_g.1 |
| ID in PlantcircBase | osa_circ_035405 |
| Alias | Os_ciR4983 |
| Organism | Oryza sativa |
| Position | chr7: 29250815-29251090 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0688300 |
| Parent gene annotation |
Similar to Importin alpha 1. (Os07t0688300-01);Similar to Import in alpha 1. (Os07t0688300-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0688300-01:2 Os07t0688300-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.198772705 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29251070-29251084(-) |
| Potential amino acid sequence |
MVEKVWSDDTTSQLEATIQFRRLLSDEKNPTVIKIIRADVLPRFSDFLSRHEHPQLQLA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |