Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0654100_circ_g.1 |
ID in PlantcircBase | osa_circ_002951 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 26516140-26516501 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0654100 |
Parent gene annotation |
Similar to CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase). (Os01t0654100-01);CTP synthase domain containing pr otein. (Os01t0654100-02);Similar to CTP synthase. (Os01t0654100- 03) |
Parent gene strand | + |
Alternative splicing | Os01g0654100_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0654100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.223315331 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26516170-26516460(+) 26516172-26516457(-) 26516147-26516500(-) |
Potential amino acid sequence |
MSPFEHGEVFVLDDGGEVDLDLGNYERFLDIKLTRDNNITTGKIYQTHTSTLMLEPCLRSSMVR SSFWTMVERWTWTLEITNVFWTSN*(+) MVPASVLRYGSDIFFPWLCCYHGSI*(-) MGLIYFSRGYVVITGQFDVQKTFVISKVQVHLSTIVQNEDLTMLERRHGSSISVEVWV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |