Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0654100_circ_g.1 |
| ID in PlantcircBase | osa_circ_002951 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 26516140-26516501 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0654100 |
| Parent gene annotation |
Similar to CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP synthetase). (Os01t0654100-01);CTP synthase domain containing pr otein. (Os01t0654100-02);Similar to CTP synthase. (Os01t0654100- 03) |
| Parent gene strand | + |
| Alternative splicing | Os01g0654100_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0654100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223315331 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26516170-26516460(+) 26516172-26516457(-) 26516147-26516500(-) |
| Potential amino acid sequence |
MSPFEHGEVFVLDDGGEVDLDLGNYERFLDIKLTRDNNITTGKIYQTHTSTLMLEPCLRSSMVR SSFWTMVERWTWTLEITNVFWTSN*(+) MVPASVLRYGSDIFFPWLCCYHGSI*(-) MGLIYFSRGYVVITGQFDVQKTFVISKVQVHLSTIVQNEDLTMLERRHGSSISVEVWV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |