Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0647100_circ_g.1 |
| ID in PlantcircBase | osa_circ_035027 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 27016819-27017300 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os07g0647100 |
| Parent gene annotation |
Mo25-like domain containing protein. (Os07t0647100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0647100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.216053959 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27017245-27017297(+) 27016871-27017276(-) |
| Potential amino acid sequence |
MKRYIVEVSYLNIMIGLLKDLLTKHEAAVSEFLCSHYEQFFELYTRLLTSTNYVTRRQSVKFLS EFLLEAPNAQIMKRYIVEVSYLNIMIGLLKDLLTKHEAAVSEFLCSHYEQFFELYTRLLTSTNY VTRRQSVKFLSEFLLEAPNAQIMKRYIVEVSYLNIMIGLLKDLLTKHEAAVSEFLCSHYEQFFE LYTRLLTSTNYVTRRQSVKFLSEFLLEAPNAQIMKRYIVEVSYLNIMIGLLK(+) MGAQKLRNCGFMFGEQILQQANHDI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |