Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d037982_circ_g.5 |
ID in PlantcircBase | zma_circ_009092 |
Alias | zma_circ_0002360 |
Organism | Zea mays |
Position | chr6: 144230765-144239048 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d037982 |
Parent gene annotation |
AMP deaminase |
Parent gene strand | - |
Alternative splicing | Zm00001d037982_circ_g.1 Zm00001d037982_circ_g.2 Zm00001d037982_circ_g.3 Zm00001d037982_circ_g.4 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d037982_T008:3 Zm00001d037982_T005:3 Zm00001d037982_T002:3 Zm00001d037982_T001:3 Zm00001d037982_T003:3 Zm00001d037982_T007:3 Zm00001d037982_T006:3 Zm00001d037982_T004:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.134481205 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
144230880-144239045(-) 144230804-144239045(-) |
Potential amino acid sequence |
MAEYRISIYGRKQSEWDQLASWIVNNELHSGNVVWLVQV*(-) MNCTVEMLSGWFRYDLNVDLLDVHADKSTFHRFDKFNLKYNPCGQSRLREIFLKQDNLIQGRFL AELTKQVFSDLSASKYQMAEYRISIYGRKQSEWDQLASWIVNNELHSGNVVWLVQV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |