Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0456900_circ_g.2 |
| ID in PlantcircBase | osa_circ_039462 |
| Alias | Os_ciR11831 |
| Organism | Oryza sativa |
| Position | chr9: 17236019-17236387 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os09g0456900 |
| Parent gene annotation |
Nucleic acid-binding, OB-fold domain containing protein. (Os09t0 456900-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0456900_circ_g.1 Os09g0456900_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0456900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.215582204 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17236386-17236171(+) 17236075-17236364(-) |
| Potential amino acid sequence |
MLGEAKTTGGHVGSAHLYPFPKRFAVLLHVSQAVYHQELSTLTFFMTTVTKN*(+) MDTGVQIQHAHQLFWLRLASKETMSQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |