Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G23310_circ_g.12 |
ID in PlantcircBase | ath_circ_004034 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 8269649-8269780 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder |
Parent gene | AT1G23310 |
Parent gene annotation |
Glutamate--glyoxylate aminotransferase 1 |
Parent gene strand | - |
Alternative splicing | AT1G23310_circ_g.1 AT1G23310_circ_g.2 AT1G23310_circ_g.3 AT1G23310_circ_g.4 AT1G23310_circ_g.5 AT1G23310_circ_g.6 AT1G23310_circ_g.7 AT1G23310_circ_g.8 AT1G23310_circ_g.9 AT1G23310_circ_g.10 AT1G23310_circ_g.11 AT1G23310_circ_g.13 AT1G23310_circ_g.14 AT1G23310_circ_g.15 AT1G23310_circ_g.16 AT1G23310_circ_g.17 AT1G23310_circ_g.18 AT1G23310_circ_g.19 AT1G23310_circ_g.20 AT1G23310_circ_g.21 |
Support reads | 548 |
Tissues | leaf, aerial, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G23310.2:1 AT1G23310.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.547351641 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8269775-8269651(-) |
Potential amino acid sequence |
MEMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPRVLMEMGSPFSKEVQLVSFHTVS KGYWGECGQRGGYFEMTNLPPRVLMEMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNLP PRVLMEMGSPFSKEVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPR(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |