Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0194600_circ_g.2 |
| ID in PlantcircBase | osa_circ_010763 |
| Alias | Os_ciR5236 |
| Organism | Oryza sativa |
| Position | chr12: 4857969-4858262 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os12g0194600 |
| Parent gene annotation |
Similar to DNA binding protein. (Os12t0194600-01);Similar to DNA binding protein. (Os12t0194600-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0194600-01:2 Os12t0194600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.290679563 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4858164-4858145(+) |
| Potential amino acid sequence |
MDFLGQQNIMLDLENKALKQRLESLSQEHLIKRCSMLRGLVLESSSTLQSSREEFKLYRQRV*( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |