Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d005687_circ_g.2 |
| ID in PlantcircBase | zma_circ_007317 |
| Alias | zma_circ_0000854, GRMZM2G527891_C1 |
| Organism | Zea mays |
| Position | chr2: 183364865-183365138 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d005687 |
| Parent gene annotation |
trehalose-6-phosphate synthase5 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d005687_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d005687_T001:1 Zm00001d005687_T002:1 Zm00001d005687_T005:1 Zm00001d005687_T006:1 Zm00001d005687_T003:1 Zm00001d005687_T004:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.243744558 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
183365064-183365123(-) |
| Potential amino acid sequence |
MHVYMETTDGSFIEPKESALVWHYQNTDHDFGSCQAKELVSHLERVLSNEPVVVRRGHQIVEVK PQMEQSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |