Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d005687_circ_g.2 |
ID in PlantcircBase | zma_circ_007317 |
Alias | zma_circ_0000854, GRMZM2G527891_C1 |
Organism | Zea mays |
Position | chr2: 183364865-183365138 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d005687 |
Parent gene annotation |
trehalose-6-phosphate synthase5 |
Parent gene strand | - |
Alternative splicing | Zm00001d005687_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d005687_T001:1 Zm00001d005687_T002:1 Zm00001d005687_T005:1 Zm00001d005687_T006:1 Zm00001d005687_T003:1 Zm00001d005687_T004:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.243744558 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
183365064-183365123(-) |
Potential amino acid sequence |
MHVYMETTDGSFIEPKESALVWHYQNTDHDFGSCQAKELVSHLERVLSNEPVVVRRGHQIVEVK PQMEQSS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |