Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0571000_circ_g.1 |
| ID in PlantcircBase | osa_circ_002265 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 21920630-21921035 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0571000 |
| Parent gene annotation |
Mitochondrial carrier protein domain containing protein. (Os01t0 571000-01);Similar to Grave disease carrier protein. (Os01t05710 00-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0571000-02:2 Os01t0571000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.386707348 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21920810-21920638(+) |
| Potential amino acid sequence |
MQVQNKQPHNANDAFRIRGTFQGLALIIRCQGWRQLFAGLSLNYVKAQL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |