Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0211800_circ_g.1 |
ID in PlantcircBase | osa_circ_033220 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 6109539-6109647 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0211800 |
Parent gene annotation |
Protein of unknown function DUF1749 family protein. (Os07t021180 0-01);Similar to predicted protein. (Os07t0211800-02) |
Parent gene strand | - |
Alternative splicing | Os07g0211800_circ_g.2 Os07g0211800_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0211800-02:1 Os07t0211800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.367736009 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6109627-6109620(-) |
Potential amino acid sequence |
MGDDDMFSSDLSEDQLRQRLGHMSTTQCQVSLPLCIYG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |