Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d038970_circ_g.2 |
ID in PlantcircBase | zma_circ_009173 |
Alias | zma_circ_0002423 |
Organism | Zea mays |
Position | chr6: 167994525-167996277 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d038970 |
Parent gene annotation |
ARM repeat superfamily protein |
Parent gene strand | + |
Alternative splicing | Zm00001d038970_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d038970_T004:5 Zm00001d038970_T001:5 Zm00001d038970_T002:5 Zm00001d038970_T003:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.107725865 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
167994680-167996259(-) |
Potential amino acid sequence |
MTSAPLGIWAKRFTVSKMIAEISSSRIYLLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |