Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d015091_circ_g.1 | 
| ID in PlantcircBase | zma_circ_008541 | 
| Alias | Zm05circ00058 | 
| Organism | Zea mays | 
| Position | chr5: 75193464-75194207 JBrowse» | 
| Reference genome | AGPv4.38 | 
| Type | u-circRNA | 
| Identification method | CIRI2 | 
| Parent gene | Zm00001d015091 | 
| Parent gene annotation | 
							Bax inhibitor 1 | 
					
| Parent gene strand | + | 
| Alternative splicing | NA | 
| Support reads | NA | 
| Tissues | leaf, endosperm | 
| Exon boundary | Yes-Yes | 
| Splicing signals | GT-AG | 
| Number of exons covered | Zm00001d015091_T004:1 Zm00001d015091_T001:2 Zm00001d015091_T003:3 Zm00001d015091_T002:2  | 
					
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA | 
| PMCS | 0.168391812 | 
| Functional Information | |
|---|---|
| Coding potential | Y | 
| Potential coding position | 
							75193993-75193833(+) | 
					
| Potential amino acid sequence | 
							MTNGCFFSLSILVTAFVGTAIAFACFTGAAMVARRREYLYLGGLLSSGLSILLWLQLAGSIFGH SATSFMFEVYLTLCAALASSAVGAYLHVVWNIGGTLTMLGCVGSIAWLFSVPVYEERKRYGLLM AAALLEGASVGPLVKLAVEFDPR*(+)  | 
					
| Sponge-miRNAs | NA | 
| circRNA-miRNA-mRNA network | VISUALIZATION | 
| Potential function description | NA | 
| Other Information | |
|---|---|
| References | Han et al., 2020 |