Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d015091_circ_g.1 |
ID in PlantcircBase | zma_circ_008541 |
Alias | Zm05circ00058 |
Organism | Zea mays |
Position | chr5: 75193464-75194207 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d015091 |
Parent gene annotation |
Bax inhibitor 1 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d015091_T004:1 Zm00001d015091_T001:2 Zm00001d015091_T003:3 Zm00001d015091_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.168391812 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
75193993-75193833(+) |
Potential amino acid sequence |
MTNGCFFSLSILVTAFVGTAIAFACFTGAAMVARRREYLYLGGLLSSGLSILLWLQLAGSIFGH SATSFMFEVYLTLCAALASSAVGAYLHVVWNIGGTLTMLGCVGSIAWLFSVPVYEERKRYGLLM AAALLEGASVGPLVKLAVEFDPR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |