Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d015091_circ_g.1 |
| ID in PlantcircBase | zma_circ_008541 |
| Alias | Zm05circ00058 |
| Organism | Zea mays |
| Position | chr5: 75193464-75194207 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d015091 |
| Parent gene annotation |
Bax inhibitor 1 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d015091_T004:1 Zm00001d015091_T001:2 Zm00001d015091_T003:3 Zm00001d015091_T002:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.168391812 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
75193993-75193833(+) |
| Potential amino acid sequence |
MTNGCFFSLSILVTAFVGTAIAFACFTGAAMVARRREYLYLGGLLSSGLSILLWLQLAGSIFGH SATSFMFEVYLTLCAALASSAVGAYLHVVWNIGGTLTMLGCVGSIAWLFSVPVYEERKRYGLLM AAALLEGASVGPLVKLAVEFDPR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |