Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0541700_circ_g.2 |
| ID in PlantcircBase | osa_circ_028713 |
| Alias | Os_ciR4871 |
| Organism | Oryza sativa |
| Position | chr5: 26894601-26896155 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0541700 |
| Parent gene annotation |
Protein of unknown function DUF1639 domain containing protein. ( Os05t0541700-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0541700_circ_g.1 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0541700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.221373687 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26894624-26894678(+) |
| Potential amino acid sequence |
MRSSAQQHQMNGIRAVASPERERPARGSNIINNNGGPPTSPDDKKGSSSGSEGSIWPKFAVALT NKEKEEDFWVFKGSKLPQRPKKRAKVIQRTVNLVCPGTWLCDLTLERYEVREKKVSKKEFRGVW SNEIFSAAASDERDPGSRLT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |