Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0751300_circ_g.4 |
| ID in PlantcircBase | osa_circ_003908 |
| Alias | Os_ciR4498 |
| Organism | Oryza sativa |
| Position | chr1: 31515692-31516148 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0751300 |
| Parent gene annotation |
Domain of unknown function DUF1084 domain containing protein. (O s01t0751300-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0751300_circ_g.5 Os01g0751300_circ_g.6 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0751300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.297900766 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31515751-31516125(-) 31516070-31515745(-) |
| Potential amino acid sequence |
MVTPRILFIFIVCLVTQVNPFSIEMNQ*(-) MTVEAPKSQIFAGFQAVLLGNTSGEHQQHGCQVYFLFYPVKPHGDSSYPLHLHRLSGDTGQPLF NRDESIGFSPLPIQMRMAKAIVTTNDSRSTKITNFCRLPSCTPGQHLRRTSTARMPGLFFVLSS KASW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |