Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0251800_circ_g.2 |
ID in PlantcircBase | osa_circ_018879 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 8004006-8005040 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os03g0251800 |
Parent gene annotation |
Conserved hypothetical protein. (Os03t0251800-01);Similar to Pos sible OmpA family member precursor. (Os03t0251800-02) |
Parent gene strand | - |
Alternative splicing | Os03g0251800_circ_g.1 |
Support reads | 2 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0251800-02:4 Os03t0251800-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.231500242 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8005025-8004379(+) 8004067-8004962(-) |
Potential amino acid sequence |
MFPIITSGLLSRGENLGIKSFEKSRIAIGAYKRSTTLISSTVIGDTFVSLLAEANGSEVGSKEH EVSSFTTIFLVSGSIFGFLGVAQVFESSPLCLLF*(+) MRDFSKDFMPRFSPRLRSPEVMIGNMKRSLLMMMKLWTLTQRKEVI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |