Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0319400_circ_g.1 |
| ID in PlantcircBase | osa_circ_019532 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 11527152-11527520 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os03g0319400 |
| Parent gene annotation |
Serine/threonine protein kinase, Cold stress tolerance, Abiotic stresses (Os03t0319400-01);Similar to CBL-interacting protein ki nase 3. (Os03t0319400-02);Similar to CBL-interacting protein kin ase 3. (Os03t0319400-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 10 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0319400-01:2 Os03t0319400-02:2 Os03t0319400-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.220906662 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11527513-11527235(+) 11527480-11527154(-) |
| Potential amino acid sequence |
MPVLVIFLLNIKSKWLCSFFNLGDNFFWRTL*(+) MNAFELISLNQALNLDNLFEAKKEYKRETRFTSQCPPKEIITKIEEAAKPLGFDIQKKNYKDRH VKEETEDQPTSMNAFELISLNQALNLDNLFEAKKEYKRETRFTSQCPPKEIITKIEEAAKPLGF DIQKKNYKDRHVKEETEDQPTSMNAFELISLNQALNLDNLFEAKKEYKRETRFTSQCPPKEIIT KIEEAAKPLGFDIQKKNYKDRHVKEETEDQPTSMNAFELISLNQALNLDNLFEAKKEYKRETRF TSQCPPKEIITKIEEAAKPLGFDIQKKNYK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |