Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0168250_circ_g.1 |
ID in PlantcircBase | osa_circ_013346 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 3688383-3689707 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0168300 |
Parent gene annotation |
Conserved hypothetical protein. (Os02t0168300-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0168250-00:2 Os02t0168300-01:2 Os02t0168250-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.100139755 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3689664-3689624(+) 3689635-3689677(-) |
Potential amino acid sequence |
MLKGSNQITEEETNGRLKRAGRWMGIAEMAEASTRSSGERQII*(+) MISDNLPLARAPRRRFRHFRDPHPASRSLQPPISFFFSDLV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |