Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0390700_circ_g.1 |
| ID in PlantcircBase | osa_circ_020149 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 15650041-15650610 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0390700 |
| Parent gene annotation |
Similar to Transthyretin-like protein. (Os03t0390700-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0390700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013097 |
| PMCS | 0.356458392 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15650093-15650066(+) 15650095-15650570(-) |
| Potential amino acid sequence |
MICASGRTAPEVLAELKRRYENRPIVELEIAAQEELKITELRLAKLFASEPVAPPSSTVGGPTS QSDKAAGVGRLECQV*(+) MNTNPNFSLYLAFQSANSCCFIRLASRTSNR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |