Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA036337_circ_g.7 |
ID in PlantcircBase | osi_circ_003411 |
Alias | 12:9299855|9302769 |
Organism | Oryza sativa ssp. indica |
Position | chr12: 9299855-9302769 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA036337 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA036337_circ_g.2 BGIOSGA036337_circ_g.3 BGIOSGA036337_circ_g.4 BGIOSGA036337_circ_g.5 BGIOSGA036337_circ_g.6 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA036337-TA:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_011257* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9302273-9302763(-) 9302747-9299905(+) |
Potential amino acid sequence |
MTTLQSLSSLRSVLMKGLESGLRNDAPDNAIAMRQKWRLCEISLEDYSFVLLSRFINTLEALGG SASLAKDVARNTTLWDTTLDALVIGINQVSFSGWKTDECIAIGNEILSWKQKGLSESEGCEDGK YIWSLRLKATLDRARRLTEEYSEALLSIFPEKVMPI*(-) MDSSCSNRHYFFREYRKKCFRVLFR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |