Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0284900_circ_g.2 |
ID in PlantcircBase | osa_circ_019226 |
Alias | Os03circ11489 |
Organism | Oryza sativa |
Position | chr3: 9800011-9800986 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder, SMALT, Segemehl |
Parent gene | Os03g0284900 |
Parent gene annotation |
Annexin repeat, conserved site domain containing protein. (Os03t 0284900-01);Annexin repeat, conserved site domain containing pro tein. (Os03t0284900-02);Hypothetical conserved gene. (Os03t02849 00-03);Similar to cDNA clone:001-032-C02, full insert sequence. (Os03t0284900-04) |
Parent gene strand | - |
Alternative splicing | Os03g0284900_circ_g.3 Os03g0284900_circ_g.4 Os03g0284900_circ_g.5 |
Support reads | 2/1 |
Tissues | leaf/seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0284900-01:3 Os03t0284900-04:3 Os03t0284900-03:3 Os03t0284900-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004736* osi_circ_012835 |
PMCS | 0.250393033 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9800904-9800954(-) |
Potential amino acid sequence |
MRKAGYQANDYYLKNLIVEWCEGVLSSGNGNREYYQLDQRKESFKLVLEKVTTFLQKDVDQNQT VDVRGLSKVESRVVVLSVLRKIKEKYLLGHIQDSFDSTQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |