Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G39660_circ_g.4 |
| ID in PlantcircBase | ath_circ_035729 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 18408825-18408938 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, CIRI-full |
| Parent gene | AT4G39660 |
| Parent gene annotation |
Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial |
| Parent gene strand | + |
| Alternative splicing | AT4G39660_circ_g.1 AT4G39660_circ_g.2 AT4G39660_circ_g.3 AT4G39660_circ_g.5 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G39660.1:1 AT4G39660.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.539790915 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18408854-18408935(+) 18408829-18408827(-) |
| Potential amino acid sequence |
MVGIELVSDRKDKTPAKAETSVLFEQLRVIGDVRGRGLMVGIELVSDRKDKTPAKAETSVLFEQ LRVIGDVRGRGLMVGIELVSDRKDKTPAKAETSVLFEQLRVIGDVRGRGLMVGIELVSDRKDKT PAKAETSVLFEQLR(+) MTLSCSNKTDVSALAGVLSFRSLTSSIPTINPLPLTSPMTLSCSNKTDVSALAGVLSFRSLTSS IPTINPLPLTSPMTLSCSNKTDVSALAGVLSFRSLTSSIPTINPLPLTSPM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |