Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d038440_circ_g.1 |
ID in PlantcircBase | zma_circ_009132 |
Alias | Zm06circ00089, GRMZM2G061105_C1 |
Organism | Zea mays |
Position | chr6: 157304415-157305847 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d038440 |
Parent gene annotation |
ribonuclease P family protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d038440_T006:5 Zm00001d038440_T008:4 Zm00001d038440_T004:5 Zm00001d038440_T002:5 Zm00001d038440_T005:6 Zm00001d038440_T001:6 Zm00001d038440_T007:5 Zm00001d038440_T003:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.137124267 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
157304493-157304454(+) 157304495-157305619(-) 157304475-157305834(-) |
Potential amino acid sequence |
MNPVYWLPKGSMSAISDQKKRTLEALQQQYTAAKAKKLQDEQVKSQKKSNFNTPKPKCDAPRGS KGPEITPRRTYAQPSHKGVAFSSSNCQQKPSTSSGEEINPVYAELSCAFHDTLSKGVVSDLDGT EVVHNVIYDIIQKGGDAGKITKGAKKLKLEKGILLDNYVQRGSRLVDSQARSLLIHSKRSKRHM SLKQHKKCGSFDLDGTFHKYDLYKPMHEMWKDYIRELMDLSPFAEYQSGSPFVGG*(+) MKLHEAPWRNRASTTNKWGPGLILGKWAQIHKLSDIVLPHLMHWLIEVVLVECTI*(-) MEKSSFNHQQMGTRIDTRQMGSDP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |