Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d038440_circ_g.1 |
| ID in PlantcircBase | zma_circ_009132 |
| Alias | Zm06circ00089, GRMZM2G061105_C1 |
| Organism | Zea mays |
| Position | chr6: 157304415-157305847 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d038440 |
| Parent gene annotation |
ribonuclease P family protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d038440_T006:5 Zm00001d038440_T008:4 Zm00001d038440_T004:5 Zm00001d038440_T002:5 Zm00001d038440_T005:6 Zm00001d038440_T001:6 Zm00001d038440_T007:5 Zm00001d038440_T003:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.137124267 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
157304493-157304454(+) 157304495-157305619(-) 157304475-157305834(-) |
| Potential amino acid sequence |
MNPVYWLPKGSMSAISDQKKRTLEALQQQYTAAKAKKLQDEQVKSQKKSNFNTPKPKCDAPRGS KGPEITPRRTYAQPSHKGVAFSSSNCQQKPSTSSGEEINPVYAELSCAFHDTLSKGVVSDLDGT EVVHNVIYDIIQKGGDAGKITKGAKKLKLEKGILLDNYVQRGSRLVDSQARSLLIHSKRSKRHM SLKQHKKCGSFDLDGTFHKYDLYKPMHEMWKDYIRELMDLSPFAEYQSGSPFVGG*(+) MKLHEAPWRNRASTTNKWGPGLILGKWAQIHKLSDIVLPHLMHWLIEVVLVECTI*(-) MEKSSFNHQQMGTRIDTRQMGSDP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |