Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0525600_circ_g.5 |
ID in PlantcircBase | osa_circ_039908 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 20537805-20537905 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os09g0525600 |
Parent gene annotation |
UBX domain containing protein. (Os09t0525600-01);Similar to UBX domain-containing protein. (Os09t0525600-02);Similar to UBX doma in-containing protein. (Os09t0525600-03) |
Parent gene strand | - |
Alternative splicing | Os09g0525600_circ_g.3 Os09g0525600_circ_g.4 |
Support reads | 2 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0525600-03:1 Os09t0525600-01:1 Os09t0525600-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.100660066 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20537863-20537859(+) 20537853-20537859(+) 20537846-20537846(-) |
Potential amino acid sequence |
MFTPSGGCVIPCSAVFQLFRLQFPCPLHQKNVL*(+) MFCNVYSLWRLCYSLLCCLPAVPLAVPLSSSSKECSVMFTPSGGCVIPCSAVFQLFRLQFPCPL HQKNVL*(+) MKRTRELQAEQLEDSRARNNTAARGSKHYRTFF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |