Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0525600_circ_g.5 |
| ID in PlantcircBase | osa_circ_039908 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 20537805-20537905 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os09g0525600 |
| Parent gene annotation |
UBX domain containing protein. (Os09t0525600-01);Similar to UBX domain-containing protein. (Os09t0525600-02);Similar to UBX doma in-containing protein. (Os09t0525600-03) |
| Parent gene strand | - |
| Alternative splicing | Os09g0525600_circ_g.3 Os09g0525600_circ_g.4 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0525600-03:1 Os09t0525600-01:1 Os09t0525600-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.100660066 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20537863-20537859(+) 20537853-20537859(+) 20537846-20537846(-) |
| Potential amino acid sequence |
MFTPSGGCVIPCSAVFQLFRLQFPCPLHQKNVL*(+) MFCNVYSLWRLCYSLLCCLPAVPLAVPLSSSSKECSVMFTPSGGCVIPCSAVFQLFRLQFPCPL HQKNVL*(+) MKRTRELQAEQLEDSRARNNTAARGSKHYRTFF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |