Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0570700_circ_g.3 |
ID in PlantcircBase | osa_circ_034443 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 23004583-23007919 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0570700 |
Parent gene annotation |
Ribosome recycling factor family protein. (Os07t0570700-01) |
Parent gene strand | + |
Alternative splicing | Os07g0570700_circ_g.1 Os07g0570700_circ_g.2 Os07g0570700_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0570700-01:9 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.20632304 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23004631-23004609(+) 23004633-23007899(-) |
Potential amino acid sequence |
MSLRAGPMRFYSRPLILQNSDKRAVLRHATIEEIEAEKSVIEDQARERMEKAIETVQNNFNTVR TGRANPAMLDRIEVEYYGTPVNLKSIAQINTPDATSLLIQPYDKSSLKLIEKTIVAANLGVTPS NDGEVIRVTVPPLTSDRRKELAKTVAKLAEEGKVAIRNIRRDAIKAYDKLEKEKKLSEDNVKDL SADLQKVTDEYMKKIEAIQKQKEQVVFQNAQTF*(+) MKFVEELKMFGRSGTQPVPSAFG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |