Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA002543_circ_g.1 |
ID in PlantcircBase | osi_circ_001758 |
Alias | 1:526164|526725 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 526164-526725 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA002543 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA002543-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_000073* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
526659-526236(+) |
Potential amino acid sequence |
MAELSTELHNFWSIWTKCSHIETLPLSTNSSPSTHRGFLKPGCAILP*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |