Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0192900_circ_g.13 |
| ID in PlantcircBase | osa_circ_036268 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 5425389-5425793 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0192900 |
| Parent gene annotation |
Nucleotide-binding, alpha-beta plait domain containing protein. (Os08t0192900-01);Similar to H0714H04.9 protein. (Os08t0192900-0 2) |
| Parent gene strand | - |
| Alternative splicing | Os08g0192900_circ_g.1 Os08g0192950_circ_g.1 Os08g0192950_circ_g.2 Os08g0192950_circ_g.3 Os08g0192950_circ_g.4 Os08g0192950_circ_g.5 Os08g0192950_circ_g.6 Os08g0192950_circ_g.7 Os08g0192950_circ_g.8 Os08g0192950_circ_g.9 Os08g0192950_circ_g.10 Os08g0192950_circ_g.11 Os08g0192950_circ_g.12 Os08g0192900_circ_g.14 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0192900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.129048683 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5425705-5425391(-) 5425440-5425474(-) |
| Potential amino acid sequence |
MDEDEKPAAPVKKTSVTAQKKKDDSDSSESESDESDSDEDAKPADPVANNGLKKGKPASSDSES DSDDEMDEDEKPAAPVKKTSVTAQKKKDDSDSSESESDESDSDEDAKPADPVANNGLKKGKPAS SDSESDSDDEMDEDEKPAAPVKKTSVTAQKKKDDSDSSESESDESDSDEDAKPADPVANNGLKK GKPASSDSESDSDDEMDEDEKPAAPVKKTSVTAQKKKDDSDSSESESDESDSDE(-) MILTALRVSQMRVIRTRMLSLRIRLLIMVLRKASQRAAILRVIQTMKWMRTRNLLLQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |