Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G279600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000413 |
| Alias | Chr04:61193773|61193961 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 61193773-61193961 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | u-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G279600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.004G279600.2:1 Gorai.004G279600.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.486331217 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
61193821-61193775(-) 61193920-61193829(+) |
| Potential amino acid sequence |
MQETLRTSAFPSTQVKVVELDFLYPSEGIHRRWEKGFRITSAAATEDQAAFILSAPKRKSQDVM QETLRTSAFPSTQVKVVELDFLYPSEGIHRRWEKGFRITSAAATEDQAAFILSAPKRKSQDVMQ ETLRTSAFPSTQVKVVELDFLYPSEGIHRRWEKGFRITSAAATEDQAAFILSAPKRKSQDVMQE TLRTSAFPSTQVK(-) MNPLARVKEIKFNNLYLGTRKSRCTQSFLHHIL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |