Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0430300_circ_g.2 |
| ID in PlantcircBase | osa_circ_028000 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 21123142-21124671 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0430300 |
| Parent gene annotation |
Protein of unknown function DUF668 family protein. (Os05t0430300 -01);Similar to predicted protein. (Os05t0430300-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0430300-01:3 Os05t0430300-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.112420414 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21123198-21123231(+) 21123171-21124627(-) 21123151-21124613(-) |
| Potential amino acid sequence |
MQQLIICVQYTAELYHELHTLDRFEQDCRRKQQELDGLGSRGDSLHMLKQDVKSQTKHVKSLKK RSLWSKNLEEIGIGTNSSASPERRCRISDAAIDYLCAIYS*(+) MLRSSFRCQSLPNSWTKVTSSSDF*(-) MPISSKFLDQSDLFFRLLTCLV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |