Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0708500_circ_g.1 |
| ID in PlantcircBase | osa_circ_032279 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 29974349-29975637 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os06g0708500 |
| Parent gene annotation |
Similar to Peptidyl-prolyl cis-trans isomerase. (Os06t0708500-01 );Similar to Peptidyl-prolyl cis-trans isomerase. (Os06t0708500- 02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0708500_circ_g.2 Os06g0708500_circ_g.3 Os06g0708500_circ_g.4 Os06g0708500_circ_g.5 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0708500-02:4 Os06t0708500-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.137912639 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29974836-29974374(+) 29975564-29974374(+) |
| Potential amino acid sequence |
MGLFGKTVPKTAENFRALCTGEKGTGKSGKALHFKGSAFHRIIPSFMIQGGDFTLGDGRGGESI YGTKFADENFKIKHTGPGEEIEGGFD*(+) MEGVVNLSMGRSSPMKTSRSSTPDQAKKSKADLTEVTHKVYFDVEIDGKPAGRVVMGLFGKTVP KTAENFRALCTGEKGTGKSGKALHFKGSAFHRIIPSFMIQGGDFTLGDGRGGESIYGTKFADEN FKIKHTGPGEEIEGGFD*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |