Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0740700_circ_g.2 |
ID in PlantcircBase | osa_circ_021807 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 30388725-30388925 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0740700 |
Parent gene annotation |
Protein similar to CwfJ, C-terminal 2 domain containing protein. (Os03t0740700-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0740700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013621 |
PMCS | 0.310939718 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30388760-30388869(-) |
Potential amino acid sequence |
MDSIPLDWLSSPPQVVFLHELLALLHASKL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |