Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G11350_circ_g.1 |
| ID in PlantcircBase | ath_circ_037570 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 3622593-3622658 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT5G11350 |
| Parent gene annotation |
DNAse I-like superfamily protein |
| Parent gene strand | + |
| Alternative splicing | AT5G11350_circ_g.2 AT5G11350_circ_g.3 AT5G11350_circ_g.4 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G11350.5:1 AT5G11350.3:1 AT5G11350.2:1 AT5G11350.4:1 AT5G11350.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.108585858 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3622626-3622655(+) |
| Potential amino acid sequence |
MKHRGYSAIWKEVDKFQDLEEEMKHRGYSAIWKEVDKFQDLEEEMKHRGYSAIWKEVDKFQDLE EEMKHRGYSAIWK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |