Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc11g068800.1_circ_g.1 |
| ID in PlantcircBase | sly_circ_003447 |
| Alias | 11:50505110|50506803 |
| Organism | Solanum lycopersicum |
| Position | chr11: 53421610-53423303 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc11g068800.1 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc11g068800.1.1:9 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.189554683 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
53422820-53421614(+) 53423010-53423287(-) |
| Potential amino acid sequence |
MPSRTFVISYIRLFCTSNVSAALFRSSIPSSACLIRLMNFFVRRPRELSYRQGPTGVTLLPEGD PD*(+) MLDLNKAADTLEVQKRRIYDITNVLEGIGLIEKKLKNRIQWKGQGVSKPGEADESVASLQAEVD KLTIEEHRLDDQIREMQESLRDLSEDENNQRWLFVTEDDIKSLPCFQNETLIAIKAPHGTTLEV PDPDEAVDYPQRRYRIVLRSTMGPIDVYLVRIPFRQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |