Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc11g068800.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003447 |
Alias | 11:50505110|50506803 |
Organism | Solanum lycopersicum |
Position | chr11: 53421610-53423303 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc11g068800.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 3 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc11g068800.1.1:9 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.189554683 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
53422820-53421614(+) 53423010-53423287(-) |
Potential amino acid sequence |
MPSRTFVISYIRLFCTSNVSAALFRSSIPSSACLIRLMNFFVRRPRELSYRQGPTGVTLLPEGD PD*(+) MLDLNKAADTLEVQKRRIYDITNVLEGIGLIEKKLKNRIQWKGQGVSKPGEADESVASLQAEVD KLTIEEHRLDDQIREMQESLRDLSEDENNQRWLFVTEDDIKSLPCFQNETLIAIKAPHGTTLEV PDPDEAVDYPQRRYRIVLRSTMGPIDVYLVRIPFRQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | fruit ripening |
Other Information | |
---|---|
References | Yin et al., 2018 |