Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0479300_circ_g.1 |
ID in PlantcircBase | osa_circ_033790 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 17410724-17411989 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0479300 |
Parent gene annotation |
Peptidase S10, serine carboxypeptidase family protein. (Os07t047 9300-01);Similar to Serine carboxypeptidase-like. (Os07t0479300- 02);Non-protein coding transcript. (Os07t0479300-03) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0479300-01:3 Os07t0479300-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017063 |
PMCS | 0.166982701 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17411927-17410782(+) 17411774-17411941(-) |
Potential amino acid sequence |
MEENIRLQTTYAPRQDIVPEVPSRNSKVHSFSEYRLLFHQL*(+) MEKFLQLKSVRESLGVGDIQFVSCSPTVYQAMLLDWMRNLEVGIPELLENDIKVLIYAGEYDLI CNWLGNSRWVNSMEWSGKEAFVSSSEEPFTVDGKEAGILKSYGPLSFLKVPLALYLALAHMLSA I*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |