Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa3G792060_circ_g.1 |
| ID in PlantcircBase | csa_circ_001997 |
| Alias | Chr3:30673632_30673787 |
| Organism | Cucumis sativus |
| Position | chrChr3: 30673632-30673787 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | ue-circRNA |
| Identification method | Find_circ |
| Parent gene | Csa3G792060 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Csa3G792060.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.154915331 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30673643-30673784(+) |
| Potential amino acid sequence |
MRGRSYSYSPSPPRSYGRRYRSPSPRGRGGRRRDLPTSLLVRNLRHDCRKSKMRGRSYSYSPSP PRSYGRRYRSPSPRGRGGRRRDLPTSLLVRNLRHDCRKSKMRGRSYSYSPSPPRSYGRRYRSPS PRGRGGRRRDLPTSLLVRNLRHDCRKSKMRGRSYSYSPSPPRSYGRRYRSPSPRGRGGRRRDLP TSLLVRNLRHDC |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | He et al., 2020 |